Lineage for d1kdha1 (1kdh A:148-242)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153720Fold a.60: SAM domain-like [47768] (11 superfamilies)
  4. 153816Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
  5. 153817Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (2 proteins)
  6. 153924Protein Terminal deoxynucleotidyl transferase [69042] (1 species)
  7. 153925Species Mouse (Mus musculus) [TaxId:10090] [69043] (3 PDB entries)
  8. 153927Domain d1kdha1: 1kdh A:148-242 [72349]
    Other proteins in same PDB: d1kdha2

Details for d1kdha1

PDB Entry: 1kdh (more details), 3 Å

PDB Description: binary complex of murine terminal deoxynucleotidyl transferase with a primer single stranded dna

SCOP Domain Sequences for d1kdha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kdha1 a.60.6.1 (A:148-242) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus)}
kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits
mkdtegipclgdkvksiiegiiedgesseakavln

SCOP Domain Coordinates for d1kdha1:

Click to download the PDB-style file with coordinates for d1kdha1.
(The format of our PDB-style files is described here.)

Timeline for d1kdha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kdha2