Lineage for d1kdha1 (1kdh A:148-242)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715906Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715907Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 2716128Protein Terminal deoxynucleotidyl transferase [69042] (1 species)
  7. 2716129Species Mouse (Mus musculus) [TaxId:10090] [69043] (3 PDB entries)
  8. 2716132Domain d1kdha1: 1kdh A:148-242 [72349]
    Other proteins in same PDB: d1kdha3, d1kdha4
    protein/DNA complex; complexed with mg, na

Details for d1kdha1

PDB Entry: 1kdh (more details), 3 Å

PDB Description: binary complex of murine terminal deoxynucleotidyl transferase with a primer single stranded dna
PDB Compounds: (A:) Terminal deoxynucleotidyltransferase short isoform

SCOPe Domain Sequences for d1kdha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kdha1 a.60.6.1 (A:148-242) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]}
kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits
mkdtegipclgdkvksiiegiiedgesseakavln

SCOPe Domain Coordinates for d1kdha1:

Click to download the PDB-style file with coordinates for d1kdha1.
(The format of our PDB-style files is described here.)

Timeline for d1kdha1: