SCOPe 2.08: Domain d1kdha1: 1kdh A:148-242

Lineage for d1kdha1 (1kdh A:148-242)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein Terminal deoxynucleotidyl transferase [69042] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [69043] (3 PDB entries)

8. Domain d1kdha1: 1kdh A:148-242 [72349]
   Other proteins in same PDB: d1kdha3, d1kdha4
   protein/DNA complex; complexed with mg, na

Details for d1kdha1

PDB Entry: 1kdh, 3 Å

PDB Description: binary complex of murine terminal deoxynucleotidyl transferase with a primer single stranded dna

PDB Compounds: (A:) Terminal deoxynucleotidyltransferase short isoform

SCOPe Domain Sequences for d1kdha1:

Sequence; same for both SEQRES and ATOM records:

>d1kdha1 a.60.6.1 (A:148-242) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]}
kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits
mkdtegipclgdkvksiiegiiedgesseakavln

Timeline for d1kdha1:

• d1kdha1 first appeared in SCOP 1.61
  
• d1kdha1 appears in SCOPe 2.07