Lineage for d1kd1z_ (1kd1 Z:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 389955Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 389984Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 389985Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 389986Protein Ribosomal protein L32e [52044] (1 species)
  7. 389987Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (18 PDB entries)
  8. 389997Domain d1kd1z_: 1kd1 Z: [72348]
    Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_
    complexed with cd, cl, k, mg, na, spr

Details for d1kd1z_

PDB Entry: 1kd1 (more details), 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui

SCOP Domain Sequences for d1kd1z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kd1z_ c.9.2.1 (Z:) Ribosomal protein L32e {Archaeon Haloarcula marismortui}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOP Domain Coordinates for d1kd1z_:

Click to download the PDB-style file with coordinates for d1kd1z_.
(The format of our PDB-style files is described here.)

Timeline for d1kd1z_: