Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.29: Ribosomal protein L31e [54574] (1 superfamily) beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342 |
Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) |
Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein) |
Protein Ribosomal protein L31e [54577] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries) Uniprot P18138 |
Domain d1kd1y_: 1kd1 Y: [72347] Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1z_ complexed with cd, cl, k, mg, na, spr |
PDB Entry: 1kd1 (more details), 3 Å
SCOPe Domain Sequences for d1kd1y_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kd1y_ d.29.1.1 (Y:) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]} ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant pskirvraarfeeegeaiveae
Timeline for d1kd1y_:
View in 3D Domains from other chains: (mouse over for more information) d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1z_ |