Lineage for d1kd1y_ (1kd1 Y:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327508Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 327509Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 327510Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 327511Protein Ribosomal protein L31e [54577] (1 species)
  7. 327512Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (12 PDB entries)
  8. 327522Domain d1kd1y_: 1kd1 Y: [72347]
    Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1z_
    complexed with cd, cl, k, mg, na, spr

Details for d1kd1y_

PDB Entry: 1kd1 (more details), 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui

SCOP Domain Sequences for d1kd1y_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kd1y_ d.29.1.1 (Y:) Ribosomal protein L31e {Archaeon Haloarcula marismortui}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOP Domain Coordinates for d1kd1y_:

Click to download the PDB-style file with coordinates for d1kd1y_.
(The format of our PDB-style files is described here.)

Timeline for d1kd1y_: