Lineage for d1kd1x_ (1kd1 X:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 505726Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 505727Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 505728Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 505729Protein Archaeal L30 (L30a) [55133] (1 species)
    long-chain member of the family; contains additional C-terminal (sub)domain
  7. 505730Species Archaeon Haloarcula marismortui [TaxId:2238] [55134] (19 PDB entries)
  8. 505741Domain d1kd1x_: 1kd1 X: [72346]
    Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1y_, d1kd1z_

Details for d1kd1x_

PDB Entry: 1kd1 (more details), 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui

SCOP Domain Sequences for d1kd1x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kd1x_ d.59.1.1 (X:) Archaeal L30 (L30a) {Archaeon Haloarcula marismortui}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOP Domain Coordinates for d1kd1x_:

Click to download the PDB-style file with coordinates for d1kd1x_.
(The format of our PDB-style files is described here.)

Timeline for d1kd1x_: