Lineage for d1kd1w_ (1kd1 W:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 276870Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 276876Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 276877Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 276878Protein Ribosomal protein L29 (L29p) [46563] (1 species)
  7. 276879Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (12 PDB entries)
  8. 276889Domain d1kd1w_: 1kd1 W: [72345]
    Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1x_, d1kd1y_, d1kd1z_
    complexed with cd, cl, k, mg, na, spr

Details for d1kd1w_

PDB Entry: 1kd1 (more details), 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui

SCOP Domain Sequences for d1kd1w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kd1w_ a.2.2.1 (W:) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOP Domain Coordinates for d1kd1w_:

Click to download the PDB-style file with coordinates for d1kd1w_.
(The format of our PDB-style files is described here.)

Timeline for d1kd1w_: