SCOP 1.61: Domain d1kd1v_: 1kd1 V:

Lineage for d1kd1v_ (1kd1 V:)

1. Root: SCOP 1.61

2. Class g: Small proteins [56992] (59 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families)

5. Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)

6. Protein Ribosomal protein L24e [57750] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (7 PDB entries)

8. Domain d1kd1v_: 1kd1 V: [72344]
   Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_

Details for d1kd1v_

PDB Entry: 1kd1, 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui

SCOP Domain Sequences for d1kd1v_:

Sequence; same for both SEQRES and ATOM records:

>d1kd1v_ g.39.1.6 (V:) Ribosomal protein L24e {Archaeon Haloarcula marismortui}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

Timeline for d1kd1v_:

• d1kd1v_ is new in SCOP 1.61
  
• d1kd1v_ appears in SCOP 1.63
  
• d1kd1v_ appears in the current release, SCOPe 2.08