| Class b: All beta proteins [48724] (111 folds) |
| Fold b.34: SH3-like barrel [50036] (10 superfamilies) |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (3 families) ![]() |
| Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins) |
| Protein Ribosomal proteins L24 (L24p) [50106] (1 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [50107] (7 PDB entries) |
| Domain d1kd1u_: 1kd1 U: [72343] Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_ |
PDB Entry: 1kd1 (more details), 3 Å
SCOP Domain Sequences for d1kd1u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kd1u_ b.34.5.1 (U:) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
Timeline for d1kd1u_:
View in 3DDomains from other chains: (mouse over for more information) d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_ |