SCOP 1.61: Domain d1kd1u_: 1kd1 U:

Lineage for d1kd1u_ (1kd1 U:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.34: SH3-like barrel [50036] (10 superfamilies)

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (3 families)

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L24 (L24p) [50106] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50107] (7 PDB entries)

8. Domain d1kd1u_: 1kd1 U: [72343]
   Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_

Details for d1kd1u_

PDB Entry: 1kd1, 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui

SCOP Domain Sequences for d1kd1u_:

Sequence; same for both SEQRES and ATOM records:

>d1kd1u_ b.34.5.1 (U:) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

Timeline for d1kd1u_:

• d1kd1u_ is new in SCOP 1.61
  
• d1kd1u_ appears in SCOP 1.63
  
• d1kd1u_ appears in the current release, SCOPe 2.08