Lineage for d1kd1t_ (1kd1 T:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189018Fold d.12: Ribosomal proteins L23 and L15e [54188] (1 superfamily)
  4. 189019Superfamily d.12.1: Ribosomal proteins L23 and L15e [54189] (2 families) (S)
  5. 189020Family d.12.1.1: L23p [54190] (1 protein)
  6. 189021Protein Ribosomal protein L23 [54191] (1 species)
  7. 189022Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (7 PDB entries)
  8. 189027Domain d1kd1t_: 1kd1 T: [72342]
    Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_

Details for d1kd1t_

PDB Entry: 1kd1 (more details), 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui

SCOP Domain Sequences for d1kd1t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kd1t_ d.12.1.1 (T:) Ribosomal protein L23 {Archaeon Haloarcula marismortui}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

SCOP Domain Coordinates for d1kd1t_:

Click to download the PDB-style file with coordinates for d1kd1t_.
(The format of our PDB-style files is described here.)

Timeline for d1kd1t_: