SCOPe 2.06: Domain d1kd1s_: 1kd1 S:

Lineage for d1kd1s_ (1kd1 S:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
   beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation

4. Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family)
   some topological similarity to prokaryotic ribosomal protein L17

5. Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)

6. Protein Ribosomal protein L22 [54845] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries)
   Uniprot P10970

8. Domain d1kd1s_: 1kd1 S: [72341]
   Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_
   complexed with cd, cl, k, mg, na, spr

Details for d1kd1s_

PDB Entry: 1kd1, 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui

PDB Compounds: (S:) ribosomal protein l22

SCOPe Domain Sequences for d1kd1s_:

Sequence; same for both SEQRES and ATOM records:

>d1kd1s_ d.55.1.1 (S:) Ribosomal protein L22 {Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

Timeline for d1kd1s_:

• d1kd1s_ first appeared in SCOP 1.61
  
• d1kd1s_ appears in SCOPe 2.05
  
• d1kd1s_ appears in SCOPe 2.07
  
• d1kd1s_ appears in the current release, SCOPe 2.08