Lineage for d1kd1s_ (1kd1 S:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2948717Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 2948718Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 2948719Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 2948720Protein Ribosomal protein L22 [54845] (5 species)
  7. 2948758Species Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries)
    Uniprot P10970
  8. 2948786Domain d1kd1s_: 1kd1 S: [72341]
    Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_
    complexed with cd, cl, k, mg, na, spr

Details for d1kd1s_

PDB Entry: 1kd1 (more details), 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui
PDB Compounds: (S:) ribosomal protein l22

SCOPe Domain Sequences for d1kd1s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kd1s_ d.55.1.1 (S:) Ribosomal protein L22 {Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOPe Domain Coordinates for d1kd1s_:

Click to download the PDB-style file with coordinates for d1kd1s_.
(The format of our PDB-style files is described here.)

Timeline for d1kd1s_: