Lineage for d1kd1r_ (1kd1 R:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227526Fold b.34: SH3-like barrel [50036] (12 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 227851Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) (S)
    many known members contain KOW motif
  5. 227852Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 227853Protein Ribosomal proteins L21e [50108] (1 species)
  7. 227854Species Archaeon Haloarcula marismortui [TaxId:2238] [50109] (8 PDB entries)
  8. 227860Domain d1kd1r_: 1kd1 R: [72340]
    Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_
    complexed with cd, cl, k, mg, na, spr

Details for d1kd1r_

PDB Entry: 1kd1 (more details), 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui

SCOP Domain Sequences for d1kd1r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kd1r_ b.34.5.1 (R:) Ribosomal proteins L21e {Archaeon Haloarcula marismortui}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

SCOP Domain Coordinates for d1kd1r_:

Click to download the PDB-style file with coordinates for d1kd1r_.
(The format of our PDB-style files is described here.)

Timeline for d1kd1r_: