Lineage for d1kd1q_ (1kd1 Q:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645350Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 645351Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 645352Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 645353Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 645354Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (40 PDB entries)
  8. 645369Domain d1kd1q_: 1kd1 Q: [72339]
    Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_
    complexed with cd, cl, k, mg, na, spr

Details for d1kd1q_

PDB Entry: 1kd1 (more details), 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui
PDB Compounds: (Q:) ribosomal protein l19e

SCOP Domain Sequences for d1kd1q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kd1q_ a.94.1.1 (Q:) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOP Domain Coordinates for d1kd1q_:

Click to download the PDB-style file with coordinates for d1kd1q_.
(The format of our PDB-style files is described here.)

Timeline for d1kd1q_: