Lineage for d1kd1p_ (1kd1 P:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980515Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 980516Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 980517Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 980609Protein Ribosomal protein L18e [52084] (1 species)
  7. 980610Species Haloarcula marismortui [TaxId:2238] [52085] (40 PDB entries)
    Uniprot P12733
  8. 980645Domain d1kd1p_: 1kd1 P: [72338]
    Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_
    complexed with cd, cl, k, mg, na, spr

Details for d1kd1p_

PDB Entry: 1kd1 (more details), 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui
PDB Compounds: (P:) ribosomal protein l18e

SCOPe Domain Sequences for d1kd1p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kd1p_ c.12.1.1 (P:) Ribosomal protein L18e {Haloarcula marismortui [TaxId: 2238]}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOPe Domain Coordinates for d1kd1p_:

Click to download the PDB-style file with coordinates for d1kd1p_.
(The format of our PDB-style files is described here.)

Timeline for d1kd1p_: