![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily) core: three turns of irregular (beta-beta-alpha)n superhelix |
![]() | Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) ![]() |
![]() | Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins) |
![]() | Protein Ribosomal protein L18e [52084] (1 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [52085] (12 PDB entries) |
![]() | Domain d1kd1p_: 1kd1 P: [72338] Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_ complexed with cd, cl, k, mg, na, spr |
PDB Entry: 1kd1 (more details), 3 Å
SCOP Domain Sequences for d1kd1p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kd1p_ c.12.1.1 (P:) Ribosomal protein L18e {Archaeon Haloarcula marismortui} sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir
Timeline for d1kd1p_:
![]() Domains from other chains: (mouse over for more information) d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_ |