Lineage for d1kd1o_ (1kd1 O:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 181999Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 182512Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 182513Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 182514Protein Ribosomal protein L18 (L18p) [53139] (2 species)
  7. 182515Species Archaeon Haloarcula marismortui [TaxId:2238] [53140] (7 PDB entries)
  8. 182520Domain d1kd1o_: 1kd1 O: [72337]
    Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_

Details for d1kd1o_

PDB Entry: 1kd1 (more details), 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui

SCOP Domain Sequences for d1kd1o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kd1o_ c.55.4.1 (O:) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOP Domain Coordinates for d1kd1o_:

Click to download the PDB-style file with coordinates for d1kd1o_.
(The format of our PDB-style files is described here.)

Timeline for d1kd1o_: