Lineage for d1kd1m_ (1kd1 M:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240543Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 240544Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 240545Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 240546Protein Ribosomal protein L15 (L15p) [52082] (1 species)
  7. 240547Species Archaeon Haloarcula marismortui [TaxId:2238] [52083] (8 PDB entries)
  8. 240553Domain d1kd1m_: 1kd1 M: [72335]
    Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_
    complexed with cd, cl, k, mg, na, spr

Details for d1kd1m_

PDB Entry: 1kd1 (more details), 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui

SCOP Domain Sequences for d1kd1m_:

Sequence, based on SEQRES records: (download)

>d1kd1m_ c.12.1.1 (M:) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
iaddfsegarekvegaggsveltdlgeerq

Sequence, based on observed residues (ATOM records): (download)

>d1kd1m_ c.12.1.1 (M:) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
segarekvegaggsveltdlgeerq

SCOP Domain Coordinates for d1kd1m_:

Click to download the PDB-style file with coordinates for d1kd1m_.
(The format of our PDB-style files is described here.)

Timeline for d1kd1m_: