Lineage for d1kd1j_ (1kd1 J:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191221Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
  4. 191297Superfamily d.41.4: Ribosomal protein L10e [54686] (1 family) (S)
  5. 191298Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 191299Protein Ribosomal protein L10e [54688] (1 species)
  7. 191300Species Archaeon Haloarcula marismortui [TaxId:2238] [54689] (7 PDB entries)
  8. 191305Domain d1kd1j_: 1kd1 J: [72332]
    Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_

Details for d1kd1j_

PDB Entry: 1kd1 (more details), 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui
PDB Compounds: (J:)

SCOP Domain Sequences for d1kd1j_:

Sequence, based on SEQRES records: (download)

>d1kd1j_ d.41.4.1 (J:) Ribosomal protein L10e {Archaeon Haloarcula marismortui}
kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
leaarvaanryvqnsgaaanykfrirkfpfhvirenkaaaaaaaaaaadgmrapfgkpvg
taarvhganhifiawvnpdpnveeawrrakmkvtptinidsspagna

Sequence, based on observed residues (ATOM records): (download)

>d1kd1j_ d.41.4.1 (J:) Ribosomal protein L10e {Archaeon Haloarcula marismortui}
kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
leaarvaanryvqnsgaaanykfrirkfpfhvirenkdgmrapfgkpvgtaarvhganhi
fiawvnpdpnveeawrrakmkvtptinidsspagna

SCOP Domain Coordinates for d1kd1j_:

Click to download the PDB-style file with coordinates for d1kd1j_.
(The format of our PDB-style files is described here.)

Timeline for d1kd1j_: