Lineage for d1kd1i_ (1kd1 I:)

  1. Root: SCOP 1.67
  2. 434008Class j: Peptides [58231] (111 folds)
  3. 435248Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 435249Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 435250Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 435251Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 435252Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (17 PDB entries)
  8. 435261Domain d1kd1i_: 1kd1 I: [72331]
    Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_
    complexed with cd, cl, k, mg, na, spr

Details for d1kd1i_

PDB Entry: 1kd1 (more details), 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui

SCOP Domain Sequences for d1kd1i_:

Sequence, based on SEQRES records: (download)

>d1kd1i_ j.84.1.1 (I:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1kd1i_ j.84.1.1 (I:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesrntlleraldd

SCOP Domain Coordinates for d1kd1i_:

Click to download the PDB-style file with coordinates for d1kd1i_.
(The format of our PDB-style files is described here.)

Timeline for d1kd1i_: