Lineage for d1kd1h_ (1kd1 H:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193619Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies)
  4. 193699Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 193700Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)
  6. 193710Protein Ribosomal protein L7ae [55319] (1 species)
  7. 193711Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (7 PDB entries)
  8. 193716Domain d1kd1h_: 1kd1 H: [72330]
    Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_

Details for d1kd1h_

PDB Entry: 1kd1 (more details), 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui

SCOP Domain Sequences for d1kd1h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kd1h_ d.79.3.1 (H:) Ribosomal protein L7ae {Archaeon Haloarcula marismortui}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr

SCOP Domain Coordinates for d1kd1h_:

Click to download the PDB-style file with coordinates for d1kd1h_.
(The format of our PDB-style files is described here.)

Timeline for d1kd1h_: