Lineage for d1kd1g1 (1kd1 G:1-79)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196967Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
  4. 196968Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 196969Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 196970Protein Ribosomal protein L6 [56055] (2 species)
  7. 196971Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (7 PDB entries)
  8. 196980Domain d1kd1g1: 1kd1 G:1-79 [72328]
    Other proteins in same PDB: d1kd11_, d1kd12_, d1kd13_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_

Details for d1kd1g1

PDB Entry: 1kd1 (more details), 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui

SCOP Domain Sequences for d1kd1g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kd1g1 d.141.1.1 (G:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

SCOP Domain Coordinates for d1kd1g1:

Click to download the PDB-style file with coordinates for d1kd1g1.
(The format of our PDB-style files is described here.)

Timeline for d1kd1g1: