SCOPe 2.05: Domain d1kd13_: 1kd1 3:

Lineage for d1kd13_ (1kd1 3:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family)
   interrupted alpha-helix
   automatically mapped to Pfam PF00832

5. Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)

6. Protein Ribosomal protein L39e [48664] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
   Uniprot P22452

8. Domain d1kd13_: 1kd1 3: [72321]
   Other proteins in same PDB: d1kd11_, d1kd12_, d1kd14_, d1kd1c1, d1kd1c2, d1kd1d_, d1kd1e_, d1kd1f_, d1kd1g1, d1kd1g2, d1kd1h_, d1kd1i_, d1kd1j_, d1kd1k_, d1kd1l_, d1kd1m_, d1kd1n_, d1kd1o_, d1kd1p_, d1kd1q_, d1kd1r_, d1kd1s_, d1kd1t_, d1kd1u_, d1kd1v_, d1kd1w_, d1kd1x_, d1kd1y_, d1kd1z_
   complexed with cd, cl, k, mg, na, spr

Details for d1kd13_

PDB Entry: 1kd1, 3 Å

PDB Description: Co-crystal Structure of Spiramycin bound to the 50S Ribosomal Subunit of Haloarcula marismortui

PDB Compounds: (3:) ribosomal protein l39e

SCOPe Domain Sequences for d1kd13_:

Sequence, based on SEQRES records:

>d1kd13_ a.137.1.1 (3:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records):

>d1kd13_ a.137.1.1 (3:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

Timeline for d1kd13_:

• d1kd13_ first appeared in SCOP 1.61
  
• d1kd13_ appears in SCOPe 2.04
  
• d1kd13_ appears in SCOPe 2.06
  
• d1kd13_ appears in the current release, SCOPe 2.08