SCOP 1.67: Domain d1kcvl1: 1kcv L:1-107

Lineage for d1kcvl1 (1kcv L:1-107)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (160 PDB entries)

8. Domain d1kcvl1: 1kcv L:1-107 [72317]
   Other proteins in same PDB: d1kcvh1, d1kcvh2, d1kcvl2
   part of anti-hepatitis B Fab pc282

Details for d1kcvl1

PDB Entry: 1kcv, 1.8 Å

PDB Description: Crystal structure of antibody pc282

SCOP Domain Sequences for d1kcvl1:

Sequence; same for both SEQRES and ATOM records:

>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
divmtqspksmgmsvgeavtlnckasenvgtyvswyqqkpgqspvlliygasnrytgvpd
rftgsgsatdftltissvqadddadyycgqsysspltfgggtklelk

Timeline for d1kcvl1:

• d1kcvl1 first appeared in SCOP 1.61
  
• d1kcvl1 appears in SCOP 1.65
  
• d1kcvl1 appears in SCOP 1.69
  
• d1kcvl1 appears in the current release, SCOPe 2.08