SCOP 1.73: Domain d1kcvh1: 1kcv H:1-116

Lineage for d1kcvh1 (1kcv H:1-116)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (36 PDB entries)

8. Domain d1kcvh1: 1kcv H:1-116 [72315]
   Other proteins in same PDB: d1kcvh2, d1kcvl1, d1kcvl2
   part of anti-hepatitis B Fab pc282

Details for d1kcvh1

PDB Entry: 1kcv, 1.8 Å

PDB Description: Crystal structure of antibody pc282

PDB Compounds: (H:) pc282 immunoglobulin

SCOP Domain Sequences for d1kcvh1:

Sequence; same for both SEQRES and ATOM records:

>d1kcvh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
qvtlsqsgpglvkpsqslsltctvtsysitsdyawnwirqfagqslewmgyisysgstsy
npslksrisitrdtsknqfflqlnsvttddtatyycarggtgfpywgtgtnvtvsa

Timeline for d1kcvh1:

• d1kcvh1 first appeared in SCOP 1.61
  
• d1kcvh1 appears in SCOP 1.71
  
• d1kcvh1 appears in SCOP 1.75
  
• d1kcvh1 appears in the current release, SCOPe 2.08