Lineage for d1kcsl1 (1kcs L:1-107)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 288075Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)
  8. 288176Domain d1kcsl1: 1kcs L:1-107 [72309]
    Other proteins in same PDB: d1kcsh1, d1kcsh2, d1kcsl2
    part of anti-hepatitis B Fab pc282; complex with ps1 peptide

Details for d1kcsl1

PDB Entry: 1kcs (more details), 2.5 Å

PDB Description: crystal structure of antibody pc282 in complex with ps1 peptide

SCOP Domain Sequences for d1kcsl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcsl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
divmtqspksmgmsvgeavtlnckasenvgtyvswyqqkpgqspvlliygasnrytgvpd
rftgsgsatdftltissvqadddadyycgqsysspltfgggtklelk

SCOP Domain Coordinates for d1kcsl1:

Click to download the PDB-style file with coordinates for d1kcsl1.
(The format of our PDB-style files is described here.)

Timeline for d1kcsl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kcsl2