Lineage for d1kcrh1 (1kcr H:1-116)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547188Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (34 PDB entries)
  8. 547220Domain d1kcrh1: 1kcr H:1-116 [72303]
    Other proteins in same PDB: d1kcrh2, d1kcrl1, d1kcrl2
    part of anti-hepatitis B Fab pc283; complex with ps1 peptide

Details for d1kcrh1

PDB Entry: 1kcr (more details), 2.9 Å

PDB Description: crystal structure of antibody pc283 in complex with ps1 peptide

SCOP Domain Sequences for d1kcrh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcrh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1}
qvalqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyirnggstty
npslasrisitrdtsknqfflqlnsvttedtatyycarggtgftywgagtlvtvsa

SCOP Domain Coordinates for d1kcrh1:

Click to download the PDB-style file with coordinates for d1kcrh1.
(The format of our PDB-style files is described here.)

Timeline for d1kcrh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kcrh2