SCOP 1.61: Domain d1kcrh1: 1kcr H:1-116

Lineage for d1kcrh1 (1kcr H:1-116)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Anti-hepatitis B Fab pc283, (mouse), kappa L chain [74815] (1 PDB entry)

8. Domain d1kcrh1: 1kcr H:1-116 [72303]
   Other proteins in same PDB: d1kcrh2, d1kcrl2

Details for d1kcrh1

PDB Entry: 1kcr, 2.9 Å

PDB Description: crystal structure of antibody pc283 in complex with ps1 peptide

SCOP Domain Sequences for d1kcrh1:

Sequence; same for both SEQRES and ATOM records:

>d1kcrh1 b.1.1.1 (H:1-116) Immunoglobulin (variable domains of L and H chains) {Anti-hepatitis B Fab pc283, (mouse), kappa L chain}
qvalqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyirnggstty
npslasrisitrdtsknqfflqlnsvttedtatyycarggtgftywgagtlvtvsa

Timeline for d1kcrh1:

• d1kcrh1 is new in SCOP 1.61
  
• d1kcrh1 appears in SCOP 1.63
  
• d1kcrh1 appears in the current release, SCOPe 2.08