SCOPe 2.06: Domain d1kcma_: 1kcm A:

Lineage for d1kcma_ (1kcm A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.4: Phoshatidylinositol transfer protein, PITP [64388] (2 proteins)
   automatically mapped to Pfam PF02121

6. Protein Phoshatidylinositol transfer protein, PITP [64389] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [75549] (1 PDB entry)

8. Domain d1kcma_: 1kcm A: [72300]

Details for d1kcma_

PDB Entry: 1kcm, 2 Å

PDB Description: Crystal Structure of Mouse PITP Alpha Void of Bound Phospholipid at 2.0 Angstroms Resolution

PDB Compounds: (A:) Phosphatidylinositol Transfer Protein alpha

SCOPe Domain Sequences for d1kcma_:

Sequence; same for both SEQRES and ATOM records:

>d1kcma_ d.129.3.4 (A:) Phoshatidylinositol transfer protein, PITP {Mouse (Mus musculus) [TaxId: 10090]}
vllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekddgekgqythk
iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
tqenvhklepeawkhveaiyidiadrsqvlskdykaeedpakfksvktgrgplgpnwkqe
lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqekrlftnfhrqlfcwldkwvdltm
ddirrmeeetkrqlde

Timeline for d1kcma_:

• d1kcma_ first appeared in SCOP 1.61
  
• d1kcma_ appears in SCOPe 2.05
  
• d1kcma_ appears in SCOPe 2.07
  
• d1kcma_ appears in the current release, SCOPe 2.08