Lineage for d1kcma_ (1kcm A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196532Fold d.129: TBP-like [55944] (4 superfamilies)
  4. 196660Superfamily d.129.3: Bet v1-like [55961] (4 families) (S)
  5. 196702Family d.129.3.4: Phoshatidylinositol transfer protein, PITP [64388] (1 protein)
  6. 196703Protein Phoshatidylinositol transfer protein, PITP [64389] (2 species)
  7. 196704Species Mouse (Mus musculus) [TaxId:10090] [75549] (1 PDB entry)
  8. 196705Domain d1kcma_: 1kcm A: [72300]

Details for d1kcma_

PDB Entry: 1kcm (more details), 2 Å

PDB Description: Crystal Structure of Mouse PITP Alpha Void of Bound Phospholipid at 2.0 Angstroms Resolution

SCOP Domain Sequences for d1kcma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcma_ d.129.3.4 (A:) Phoshatidylinositol transfer protein, PITP {Mouse (Mus musculus)}
vllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekddgekgqythk
iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
tqenvhklepeawkhveaiyidiadrsqvlskdykaeedpakfksvktgrgplgpnwkqe
lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqekrlftnfhrqlfcwldkwvdltm
ddirrmeeetkrqlde

SCOP Domain Coordinates for d1kcma_:

Click to download the PDB-style file with coordinates for d1kcma_.
(The format of our PDB-style files is described here.)

Timeline for d1kcma_: