Lineage for d1kcma_ (1kcm A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975789Family d.129.3.4: Phoshatidylinositol transfer protein, PITP [64388] (2 proteins)
    automatically mapped to Pfam PF02121
  6. 2975790Protein Phoshatidylinositol transfer protein, PITP [64389] (4 species)
  7. 2975796Species Mouse (Mus musculus) [TaxId:10090] [75549] (1 PDB entry)
  8. 2975797Domain d1kcma_: 1kcm A: [72300]

Details for d1kcma_

PDB Entry: 1kcm (more details), 2 Å

PDB Description: Crystal Structure of Mouse PITP Alpha Void of Bound Phospholipid at 2.0 Angstroms Resolution
PDB Compounds: (A:) Phosphatidylinositol Transfer Protein alpha

SCOPe Domain Sequences for d1kcma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcma_ d.129.3.4 (A:) Phoshatidylinositol transfer protein, PITP {Mouse (Mus musculus) [TaxId: 10090]}
vllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekddgekgqythk
iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
tqenvhklepeawkhveaiyidiadrsqvlskdykaeedpakfksvktgrgplgpnwkqe
lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqekrlftnfhrqlfcwldkwvdltm
ddirrmeeetkrqlde

SCOPe Domain Coordinates for d1kcma_:

Click to download the PDB-style file with coordinates for d1kcma_.
(The format of our PDB-style files is described here.)

Timeline for d1kcma_: