Lineage for d1kcca_ (1kcc A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 171509Fold b.80: Single-stranded right-handed beta-helix [51125] (5 superfamilies)
  4. 171510Superfamily b.80.1: Pectin lyase-like [51126] (8 families) (S)
  5. 171536Family b.80.1.3: Galacturonase [51137] (2 proteins)
  6. 171537Protein Polygalacturonase [51140] (5 species)
  7. 171540Species Fungi (Stereum purpureum), endo-polygalacturonase I [TaxId:58369] [75025] (3 PDB entries)
  8. 171542Domain d1kcca_: 1kcc A: [72298]

Details for d1kcca_

PDB Entry: 1kcc (more details), 1 Å

PDB Description: endopolygalacturonase i from stereum purpureum complexed with a galacturonate at 1.00 a resolution.

SCOP Domain Sequences for d1kcca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcca_ b.80.1.3 (A:) Polygalacturonase {Fungi (Stereum purpureum), endo-polygalacturonase I}
ctvksvddakdiagcsavtlngftvpagntlvlnpdkgatvtmagditfakttldgplft
idgtginfvgadhifdgngalywdgkgtnngthkphpflkikgsgtykkfevlnspaqai
svgptdahltldgitvddfagdtknlghntdgfdvsannvtiqncivknqddciaindgn
nirfennqcsgghgisigsiatgkhvsnvvikgntvtrsmygvrikaqrtatsasvsgvt
ydantisgiakygvlisqsypddvgnpgtgapfsdvnftggattikvnnaatrvtvecgn
csgnwnwsqltvtggkagtiksdkakitggqyl

SCOP Domain Coordinates for d1kcca_:

Click to download the PDB-style file with coordinates for d1kcca_.
(The format of our PDB-style files is described here.)

Timeline for d1kcca_: