| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries) |
| Domain d1kc5l2: 1kc5 L:108-214 [72297] Other proteins in same PDB: d1kc5h1, d1kc5h2, d1kc5l1 part of anti-hepatitis B Fab pc287; complex with ps1 peptide |
PDB Entry: 1kc5 (more details), 2.5 Å
SCOP Domain Sequences for d1kc5l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kc5l2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvanswtaqd
skdstysmsstltltkdeyerhnsytceathktstspvvksfnrnec
Timeline for d1kc5l2: