SCOP 1.65: Domain d1kc5l2: 1kc5 L:108-214

Lineage for d1kc5l2 (1kc5 L:108-214)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)

8. Domain d1kc5l2: 1kc5 L:108-214 [72297]
   Other proteins in same PDB: d1kc5h1, d1kc5h2, d1kc5l1
   part of anti-hepatitis B Fab pc287; complex with ps1 peptide

Details for d1kc5l2

PDB Entry: 1kc5, 2.5 Å

PDB Description: crystal structure of antibody pc287 in complex with ps1 peptide

SCOP Domain Sequences for d1kc5l2:

Sequence; same for both SEQRES and ATOM records:

>d1kc5l2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvanswtaqd
skdstysmsstltltkdeyerhnsytceathktstspvvksfnrnec

Timeline for d1kc5l2:

• d1kc5l2 first appeared in SCOP 1.61
  
• d1kc5l2 appears in SCOP 1.63
  
• d1kc5l2 appears in SCOP 1.67
  
• d1kc5l2 appears in the current release, SCOPe 2.08