SCOP 1.61: Domain d1kc5l1: 1kc5 L:1-107

Lineage for d1kc5l1 (1kc5 L:1-107)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Anti-hepatitis B Fab pc287, (mouse), kappa L chain [74817] (2 PDB entries)

8. Domain d1kc5l1: 1kc5 L:1-107 [72296]
   Other proteins in same PDB: d1kc5h2, d1kc5l2

Details for d1kc5l1

PDB Entry: 1kc5, 2.5 Å

PDB Description: crystal structure of antibody pc287 in complex with ps1 peptide

SCOP Domain Sequences for d1kc5l1:

Sequence; same for both SEQRES and ATOM records:

>d1kc5l1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-hepatitis B Fab pc287, (mouse), kappa L chain}
divltqspksmsmsvgekvtlsckasenvdtyvswyqqrpeqppalliygasnrytgvpd
rftgsgsatdftltissvqaedladyhcgqsysypltfgggtklelk

Timeline for d1kc5l1:

• d1kc5l1 is new in SCOP 1.61
  
• d1kc5l1 appears in SCOP 1.63
  
• d1kc5l1 appears in the current release, SCOPe 2.08