SCOP 1.61: Domain d1kc5h2: 1kc5 H:117-217

Lineage for d1kc5h2 (1kc5 H:117-217)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Anti-hepatitis B Fab pc287, (mouse), kappa L chain [74834] (2 PDB entries)

8. Domain d1kc5h2: 1kc5 H:117-217 [72295]
   Other proteins in same PDB: d1kc5h1, d1kc5l1

Details for d1kc5h2

PDB Entry: 1kc5, 2.5 Å

PDB Description: crystal structure of antibody pc287 in complex with ps1 peptide

SCOP Domain Sequences for d1kc5h2:

Sequence; same for both SEQRES and ATOM records:

>d1kc5h2 b.1.1.2 (H:117-217) Immunoglobulin (constant domains of L and H chains) {Anti-hepatitis B Fab pc287, (mouse), kappa L chain}
aattppsvyplapgsataaasmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsd
lytlsssvtvpsspwpsetvtcnvahpasstkvdkkivprd

Timeline for d1kc5h2:

• d1kc5h2 is new in SCOP 1.61
  
• d1kc5h2 appears in SCOP 1.63
  
• d1kc5h2 appears in the current release, SCOPe 2.08