Lineage for d1kc3a_ (1kc3 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842004Protein dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) [75102] (2 species)
  7. 2842007Species Salmonella typhimurium [TaxId:90371] [75103] (4 PDB entries)
  8. 2842011Domain d1kc3a_: 1kc3 A: [72292]
    complexed with mg, ndp, trh
    has additional subdomain(s) that are not in the common domain

Details for d1kc3a_

PDB Entry: 1kc3 (more details), 2.7 Å

PDB Description: Crystal structure of dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) in complex with NADPH and dTDP-L-rhamnose
PDB Compounds: (A:) dTDP-glucose oxidoreductase

SCOPe Domain Sequences for d1kc3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kc3a_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella typhimurium [TaxId: 90371]}
mnillfgktgqvgwelqrslapvgnlialdvhskefcgdfsnpkgvaetvrklrpdvivn
aaahtavdkaesepelaqllnatsveaiakaanetgawvvhystdyvfpgtgdipwqetd
atsplnvygktklagekalqdncpkhlifrtswvyagkgnnfaktmlrlakerqtlsvin
dqygaptgaelladctahairvalnkpevaglyhlvaggtttwhdyaalvfdearkagit
laltelnavptsayptpasrpgnsrlntekfqrnfdlilpqwelgvkrmltemftttt

SCOPe Domain Coordinates for d1kc3a_:

Click to download the PDB-style file with coordinates for d1kc3a_.
(The format of our PDB-style files is described here.)

Timeline for d1kc3a_: