Lineage for d1kc2a_ (1kc2 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965246Protein c-src tyrosine kinase [55556] (4 species)
  7. 2965309Species Rous sarcoma virus [TaxId:11886] [69782] (12 PDB entries)
  8. 2965314Domain d1kc2a_: 1kc2 A: [72291]
    complexed with co; mutant

Details for d1kc2a_

PDB Entry: 1kc2 (more details), 2.1 Å

PDB Description: structure of the triple (lys(beta)d3ala, asp(beta)c8ala, aspcd2ala) mutant of the src sh2 domain bound to the pqpyeeipi peptide
PDB Compounds: (A:) Src Tyrosine kinase

SCOPe Domain Sequences for d1kc2a_:

Sequence, based on SEQRES records: (download)

>d1kc2a_ d.93.1.1 (A:) c-src tyrosine kinase {Rous sarcoma virus [TaxId: 11886]}
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsafanakglnvahyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

Sequence, based on observed residues (ATOM records): (download)

>d1kc2a_ d.93.1.1 (A:) c-src tyrosine kinase {Rous sarcoma virus [TaxId: 11886]}
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvslnvahykirkldsgg
fyitsrtqfsslqqlvayyskhadglchrltnvcpt

SCOPe Domain Coordinates for d1kc2a_:

Click to download the PDB-style file with coordinates for d1kc2a_.
(The format of our PDB-style files is described here.)

Timeline for d1kc2a_: