Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) [75102] (2 species) |
Species Salmonella typhimurium [TaxId:90371] [75103] (4 PDB entries) |
Domain d1kc1a_: 1kc1 A: [72290] complexed with mg, ndp, so4 has additional subdomain(s) that are not in the common domain |
PDB Entry: 1kc1 (more details), 2.6 Å
SCOPe Domain Sequences for d1kc1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kc1a_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella typhimurium [TaxId: 90371]} mnillfgktgqvgwelqrslapvgnlialdvhskefcgdfsnpkgvaetvrklrpdvivn aaahtavdkaesepelaqllnatsveaiakaanetgawvvhystdyvfpgtgdipwqetd atsplnvygktklagekalqdncpkhlifrtswvyagkgnnfaktmlrlakerqtlsvin dqygaptgaelladctahairvalnkpevaglyhlvaggtttwhdyaalvfdearkagit laltelnavptsayptpasrpgnsrlntekfqrnfdlilpqwelgvkrmltemftttt
Timeline for d1kc1a_: