SCOPe 2.08: Domain d1kc1a_: 1kc1 A:

Lineage for d1kc1a_ (1kc1 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) [75102] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [75103] (4 PDB entries)

8. Domain d1kc1a_: 1kc1 A: [72290]
   complexed with mg, ndp, so4
   has additional subdomain(s) that are not in the common domain

Details for d1kc1a_

PDB Entry: 1kc1, 2.6 Å

PDB Description: Crystal structure of dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) in complex with NADPH

PDB Compounds: (A:) dTDP-glucose oxidoreductase

SCOPe Domain Sequences for d1kc1a_:

Sequence; same for both SEQRES and ATOM records:

>d1kc1a_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella typhimurium [TaxId: 90371]}
mnillfgktgqvgwelqrslapvgnlialdvhskefcgdfsnpkgvaetvrklrpdvivn
aaahtavdkaesepelaqllnatsveaiakaanetgawvvhystdyvfpgtgdipwqetd
atsplnvygktklagekalqdncpkhlifrtswvyagkgnnfaktmlrlakerqtlsvin
dqygaptgaelladctahairvalnkpevaglyhlvaggtttwhdyaalvfdearkagit
laltelnavptsayptpasrpgnsrlntekfqrnfdlilpqwelgvkrmltemftttt

Timeline for d1kc1a_:

• d1kc1a_ first appeared in SCOP 1.61
  
• d1kc1a_ appears in SCOPe 2.07