Lineage for d1kc0a_ (1kc0 A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175154Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (28 proteins)
  6. 175278Protein dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) [75102] (1 species)
  7. 175279Species Salmonella enterica serovar typhimurium [TaxId:90371] [75103] (4 PDB entries)
  8. 175280Domain d1kc0a_: 1kc0 A: [72289]

Details for d1kc0a_

PDB Entry: 1kc0 (more details), 2 Å

PDB Description: Crystal structure of dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) in complex with NADH

SCOP Domain Sequences for d1kc0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kc0a_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium}
mnillfgktgqvgwelqrslapvgnlialdvhskefcgdfsnpkgvaetvrklrpdvivn
aaahtavdkaesepelaqllnatsveaiakaanetgawvvhystdyvfpgtgdipwqetd
atsplnvygktklagekalqdncpkhlifrtswvyagkgnnfaktmlrlakerqtlsvin
dqygaptgaelladctahairvalnkpevaglyhlvaggtttwhdyaalvfdearkagit
laltelnavptsayptpasrpgnsrlntekfqrnfdlilpqwelgvkrmltemftttt

SCOP Domain Coordinates for d1kc0a_:

Click to download the PDB-style file with coordinates for d1kc0a_.
(The format of our PDB-style files is described here.)

Timeline for d1kc0a_:

  • d1kc0a_ is new in SCOP 1.61
  • d1kc0a_ became obsolete in SCOP 1.63