SCOPe 2.08: Domain d1kbub1: 1kbu B:19-129

Lineage for d1kbub1 (1kbu B:19-129)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (2 families)

5. Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)

6. Protein Cre recombinase [47825] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [47826] (20 PDB entries)
   Uniprot P06956 20-341

8. Domain d1kbub1: 1kbu B:19-129 [72286]
   Other proteins in same PDB: d1kbua2, d1kbub2
   protein/DNA complex

Details for d1kbub1

PDB Entry: 1kbu, 2.2 Å

PDB Description: cre recombinase bound to a loxp holliday junction

PDB Compounds: (B:) cre recombinase

SCOPe Domain Sequences for d1kbub1:

Sequence; same for both SEQRES and ATOM records:

>d1kbub1 a.60.9.1 (B:19-129) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
tsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllyl
qarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

Timeline for d1kbub1:

• d1kbub1 first appeared in SCOP 1.61
  
• d1kbub1 appears in SCOPe 2.07