SCOP 1.73: Domain d1kbua2: 1kbu A:130-341

Lineage for d1kbua2 (1kbu A:130-341)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
   core: alpha3-beta3-alpha4; one side of beta-sheet is exposed

4. Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families)

5. Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)

6. Protein Cre recombinase [56355] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [56356] (18 PDB entries)

8. Domain d1kbua2: 1kbu A:130-341 [72285]
   Other proteins in same PDB: d1kbua1, d1kbub1

Details for d1kbua2

PDB Entry: 1kbu, 2.2 Å

PDB Description: cre recombinase bound to a loxp holliday junction

PDB Compounds: (A:) cre recombinase

SCOP Domain Sequences for d1kbua2:

Sequence; same for both SEQRES and ATOM records:

>d1kbua2 d.163.1.1 (A:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

Timeline for d1kbua2:

• d1kbua2 first appeared in SCOP 1.61
  
• d1kbua2 appears in SCOP 1.71
  
• d1kbua2 appears in SCOP 1.75
  
• d1kbua2 appears in the current release, SCOPe 2.08