Lineage for d1kbia2 (1kbi A:1-97)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 333747Fold d.120: Cytochrome b5 [55855] (1 superfamily)
    small, heme-binding fold
  4. 333748Superfamily d.120.1: Cytochrome b5 [55856] (1 family) (S)
  5. 333749Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)
  6. 333799Protein Flavocytochrome b2, N-terminal domain [55864] (1 species)
    C-terminal domain is beta/alpha barrel
  7. 333800Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55865] (5 PDB entries)
  8. 333801Domain d1kbia2: 1kbi A:1-97 [72278]
    Other proteins in same PDB: d1kbia1, d1kbib_
    complexed with fmn, hem, mpd, po4, pyr

Details for d1kbia2

PDB Entry: 1kbi (more details), 2.3 Å

PDB Description: Crystallographic Study of the Recombinant Flavin-binding Domain of Baker's Yeast Flavocytochrome b2: Comparison with the Intact Wild-type Enzyme

SCOP Domain Sequences for d1kbia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbia2 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
ifeplhapnvidkyiapekklgplqgsmppelvcppy

SCOP Domain Coordinates for d1kbia2:

Click to download the PDB-style file with coordinates for d1kbia2.
(The format of our PDB-style files is described here.)

Timeline for d1kbia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kbia1
View in 3D
Domains from other chains:
(mouse over for more information)
d1kbib_