| Class b: All beta proteins [48724] (149 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Animal alpha-amylase [51024] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [51026] (27 PDB entries) |
| Domain d1kbba1: 1kbb A:404-496 [72275] Other proteins in same PDB: d1kbba2 complexed with ca, cl, pca; mutant |
PDB Entry: 1kbb (more details), 1.9 Å
SCOP Domain Sequences for d1kbba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kbba1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens)}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl
Timeline for d1kbba1: