Lineage for d1kb4a_ (1kb4 A:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 204719Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 204720Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 204734Family g.39.1.2: Nuclear receptor [57721] (8 proteins)
  6. 204780Protein Vitamin D3 receptor, VDR [75686] (1 species)
  7. 204781Species Human (Homo sapiens) [TaxId:9606] [75687] (3 PDB entries)
  8. 204784Domain d1kb4a_: 1kb4 A: [72271]

Details for d1kb4a_

PDB Entry: 1kb4 (more details), 2.8 Å

PDB Description: Crystal Structure of VDR DNA-binding Domain Bound to a Canonical Direct Repeat with Three Base Pair Spacer (DR3) Response Element

SCOP Domain Sequences for d1kb4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb4a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR {Human (Homo sapiens)}
ricgvcgdratgfhfnamtcegckgffrrsmkrkalftcpfngdcritkdnrrhcqacrl
krcvdigmmkefiltdeevqrkremilkrkeee

SCOP Domain Coordinates for d1kb4a_:

Click to download the PDB-style file with coordinates for d1kb4a_.
(The format of our PDB-style files is described here.)

Timeline for d1kb4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kb4b_