Lineage for d1kb2b_ (1kb2 B:)
- Root: SCOP 1.61
Class g: Small proteins [56992] (59 folds) 
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) 
Family g.39.1.2: Nuclear receptor [57721] (8 proteins) 
Protein Vitamin D3 receptor, VDR [75686] (1 species) Species Human (Homo sapiens) [TaxId:9606] [75687] (3 PDB entries) 
Domain d1kb2b_: 1kb2 B: [72268]
Details for d1kb2b_
PDB Entry: 1kb2 (more details), 2.7 Å
PDB Description: Crystal Structure of VDR DNA-binding Domain Bound to Mouse Osteopontin (SPP) Response Element
SCOP Domain Sequences for d1kb2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kb2b_ g.39.1.2 (B:) Vitamin D3 receptor, VDR {Human (Homo sapiens)}
ricgvcgdratgfhfnamtcegckgffrrsmkrkalftcpfngdcritkdnrrhcqacrl
krcvdigmmkefiltdeevqrkrem
SCOP Domain Coordinates for d1kb2b_:
Click to download the PDB-style file with coordinates for d1kb2b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kb2b_:
- d1kb2b_ is new in SCOP 1.61
- d1kb2b_ appears in SCOP 1.63
- d1kb2b_ appears in the current release, SCOPe 2.08
View in 3D
