Lineage for d1kaqf_ (1kaq F:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1359291Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1359292Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1359548Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 1359577Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (7 species)
  7. 1359590Species Bacillus subtilis [TaxId:1423] [75164] (2 PDB entries)
  8. 1359600Domain d1kaqf_: 1kaq F: [72263]
    complexed with dnd

Details for d1kaqf_

PDB Entry: 1kaq (more details), 3.2 Å

PDB Description: Structure of Bacillus subtilis Nicotinic Acid Mononucleotide Adenylyl Transferase
PDB Compounds: (F:) nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d1kaqf_:

Sequence, based on SEQRES records: (download)

>d1kaqf_ c.26.1.3 (F:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]}
kkigifggtfdpphnghllmanevlyqagldeiwfmpnqipphkqnedytdsfhrvemlk
laiqsnpsfklelvemeregpsytfdtvsllkqrypndqlffiigadmieylpkwyklde
llnliqfigvkrpgfhvetpypllfadvpefevsstmirerfkskkptdylipdkvkkyv
een

Sequence, based on observed residues (ATOM records): (download)

>d1kaqf_ c.26.1.3 (F:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]}
kkigifggtfdpphnghllmanevlyqagldeiwfmpnqidsfhrvemlklaiqsnpsfk
lelvemeregpsytfdtvsllkqrypndqlffiigadmieylpkwykldellnliqfigv
vetpypllfadvpefevsstmirerfkskkptdylipdkvkkyveen

SCOPe Domain Coordinates for d1kaqf_:

Click to download the PDB-style file with coordinates for d1kaqf_.
(The format of our PDB-style files is described here.)

Timeline for d1kaqf_: