Lineage for d1kaqd_ (1kaq D:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) 
Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) 
Family c.26.1.3: Adenylyltransferase [52397] (3 proteins) 
Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (4 species) 
Species Bacillus subtilis [TaxId:1423] [75164] (2 PDB entries) 
Domain d1kaqd_: 1kaq D: [72261]
Details for d1kaqd_
PDB Entry: 1kaq (more details), 3.2 Å
PDB Description: Structure of Bacillus subtilis Nicotinic Acid Mononucleotide Adenylyl Transferase
SCOP Domain Sequences for d1kaqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kaqd_ c.26.1.3 (D:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis}
kkigifggtfdpphnghllmanevlyqagldeiwfmpnqipphkqnedytdsfhrvemlk
laiqsnpsfklelvemeregpsytfdtvsllkqrypndqlffiigadmieylpkwyklde
llnliqfigvkrpgfhvetpypllfadvpefevsstmirerfkskkptdylipdkvkkyv
eengly
SCOP Domain Coordinates for d1kaqd_:
Click to download the PDB-style file with coordinates for d1kaqd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kaqd_:
- d1kaqd_ is new in SCOP 1.61
- d1kaqd_ appears in SCOP 1.63
- d1kaqd_ appears in the current release, SCOPe 2.08
View in 3D
