SCOPe 2.05: Domain d1kaqb_: 1kaq B:

Lineage for d1kaqb_ (1kaq B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)

6. Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species)

7. Species Bacillus subtilis [TaxId:1423] [75164] (2 PDB entries)

8. Domain d1kaqb_: 1kaq B: [72259]
   complexed with dnd

Details for d1kaqb_

PDB Entry: 1kaq, 3.2 Å

PDB Description: Structure of Bacillus subtilis Nicotinic Acid Mononucleotide Adenylyl Transferase

PDB Compounds: (B:) nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d1kaqb_:

Sequence; same for both SEQRES and ATOM records:

>d1kaqb_ c.26.1.3 (B:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]}
kkigifggtfdpphnghllmanevlyqagldeiwfmpnqipphkqnedytdsfhrvemlk
laiqsnpsfklelvemeregpsytfdtvsllkqrypndqlffiigadmieylpkwyklde
llnliqfigvkrpgfhvetpypllfadvpefevsstmirerfkskkptdylipdkvkkyv
eengly

Timeline for d1kaqb_:

• d1kaqb_ first appeared in SCOP 1.61
  
• d1kaqb_ appears in SCOPe 2.04
  
• d1kaqb_ appears in SCOPe 2.06
  
• d1kaqb_ appears in the current release, SCOPe 2.08