Lineage for d1kamc_ (1kam C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590100Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1590385Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 1590414Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (7 species)
  7. 1590427Species Bacillus subtilis [TaxId:1423] [75164] (2 PDB entries)
  8. 1590430Domain d1kamc_: 1kam C: [72256]

Details for d1kamc_

PDB Entry: 1kam (more details), 2.1 Å

PDB Description: Structure of Bacillus subtilis Nicotinic Acid Mononucleotide Adenylyl Transferase
PDB Compounds: (C:) nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d1kamc_:

Sequence, based on SEQRES records: (download)

>d1kamc_ c.26.1.3 (C:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]}
skkigifggtfdpphnghllmanevlyqagldeiwfmpnqipphkqnedytdsfhrveml
klaiqsnpsfklelvemeregpsytfdtvsllkqrypndqlffiigadmieylpkwykld
ellnliqfigvkrpgfhvetpypllfadvpefevsstmirerfkskkptdylipdkvkky
veenglye

Sequence, based on observed residues (ATOM records): (download)

>d1kamc_ c.26.1.3 (C:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]}
skkigifggtfdpphnghllmanevlyqagldeiwfmpnqipdsfhrvemlklaiqsnps
fklelvemeregpsytfdtvsllkqrypndqlffiigadmieylpkwykldellnliqfi
gvkrpgfhvetpypllfadvpefevsstmirerfkskkptdylipdkvkkyveenglye

SCOPe Domain Coordinates for d1kamc_:

Click to download the PDB-style file with coordinates for d1kamc_.
(The format of our PDB-style files is described here.)

Timeline for d1kamc_: